GSC Rabbit mAb, Clone: [ARC2343], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19817S
Artikelname: GSC Rabbit mAb, Clone: [ARC2343], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19817S
Hersteller Artikelnummer: CNA19817S
Alternativnummer: MBL-CNA19817S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSC (P56915).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2343]
Molekulargewicht: 28kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACC
Target-Kategorie: GSC
Application Verdünnung: WB: WB,1:500 - 1:2000