eIF2C3 Rabbit mAb, Clone: [ARC2345], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19819S
Artikelname: eIF2C3 Rabbit mAb, Clone: [ARC2345], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19819S
Hersteller Artikelnummer: CNA19819S
Alternativnummer: MBL-CNA19819S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2345]
Molekulargewicht: 97kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDPQALAKAVQIHQDTLRTMYFA
Target-Kategorie: AGO3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200