LSD2/KDM1B/AOF1 Rabbit mAb, Clone: [ARC2347], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19820S
Artikelname: LSD2/KDM1B/AOF1 Rabbit mAb, Clone: [ARC2347], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19820S
Hersteller Artikelnummer: CNA19820S
Alternativnummer: MBL-CNA19820S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LSD2/KDM1B/AOF1 (NP_694587.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2347]
Molekulargewicht: 92kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYY
Target-Kategorie: KDM1B
Application Verdünnung: WB: WB,1:500 - 1:1000