GCET2 Rabbit mAb, Clone: [ARC2349], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19823S
Artikelname: GCET2 Rabbit mAb, Clone: [ARC2349], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19823S
Hersteller Artikelnummer: CNA19823S
Alternativnummer: MBL-CNA19823S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human GCET2 (Q8N6F7).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2349]
Molekulargewicht: 21kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
Target-Kategorie: GCSAM
Application Verdünnung: WB: WB,1:500 - 1:2000