TAB3 Rabbit mAb, Clone: [ARC2350], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19824S
Artikelname: |
TAB3 Rabbit mAb, Clone: [ARC2350], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA19824S |
Hersteller Artikelnummer: |
CNA19824S |
Alternativnummer: |
MBL-CNA19824S |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TAB3 (Q8N5C8). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC2350] |
Molekulargewicht: |
79kDa |
Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequenz: |
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVH |
Target-Kategorie: |
TAB3 |
Application Verdünnung: |
WB: WB,1:500 - 1:1000 |