Cytokeratin 6 (KRT6) Rabbit mAb, Clone: [ARC2352], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19827S
Artikelname: Cytokeratin 6 (KRT6) Rabbit mAb, Clone: [ARC2352], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19827S
Hersteller Artikelnummer: CNA19827S
Alternativnummer: MBL-CNA19827S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (KRT6) (P48668).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2352]
Molekulargewicht: 60kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: YRKLLEGEECRLNGEGVGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH
Target-Kategorie: KRT6C
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200