MEK3/MEK6 Rabbit mAb, Clone: [ARC2356], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19830S
Artikelname: MEK3/MEK6 Rabbit mAb, Clone: [ARC2356], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19830S
Hersteller Artikelnummer: CNA19830S
Alternativnummer: MBL-CNA19830S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 248-347 of human MEK3/MEK6 (P46734).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2356]
Molekulargewicht: 39,37kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Target-Kategorie: MAP2K3/MAP2K6
Application Verdünnung: WB: WB,1:500 - 1:1000