Lambda Light chain Rabbit mAb, Clone: [ARC2357], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19831S
Artikelname: Lambda Light chain Rabbit mAb, Clone: [ARC2357], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19831S
Hersteller Artikelnummer: CNA19831S
Alternativnummer: MBL-CNA19831S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Lambda Light chain (P01701).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2357]
Molekulargewicht: 12kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MTCSPLLLTLLIHCTGSWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Target-Kategorie: IGLV1-51
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200