HLA-DRB1 Rabbit mAb, Clone: [ARC2360], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19835S
Artikelname: HLA-DRB1 Rabbit mAb, Clone: [ARC2360], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19835S
Hersteller Artikelnummer: CNA19835S
Alternativnummer: MBL-CNA19835S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HLA-DRB1 (P01911).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2360]
Molekulargewicht: 30kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Target-Kategorie: HLA-DRB1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200