AP2B1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1995P
Artikelname: AP2B1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1995P
Hersteller Artikelnummer: CNA1995P
Alternativnummer: MBL-CNA1995P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 752-951 of human AP2B1 (NP_001025177.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 105kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Target-Kategorie: AP2B1
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200