SMARCA5/SNF2H Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2000S
Artikelname: SMARCA5/SNF2H Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2000S
Hersteller Artikelnummer: CNA2000S
Alternativnummer: MBL-CNA2000S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-400 of human SMARCA5/SNF2H (NP_003592.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 122kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNF
Target-Kategorie: SMARCA5
Application Verdünnung: WB: WB,1:500 - 1:2000