[KO Validated] BRD4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20019T
Artikelname: |
[KO Validated] BRD4 Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA20019T |
Hersteller Artikelnummer: |
CNA20019T |
Alternativnummer: |
MBL-CNA20019T |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 623-722 of human BRD4 (NP_055114.1). |
Konjugation: |
Unconjugated |
Klonalität: |
Polyclonal |
Molekulargewicht: |
80kDa/88kDa/152kDa |
Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
Sequenz: |
NKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETGPA |
Target-Kategorie: |
BRD4 |
Application Verdünnung: |
WB: WB,1:500 - 1:2000 |