TNFSF14/LIGHT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2002P
Artikelname: TNFSF14/LIGHT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2002P
Hersteller Artikelnummer: CNA2002P
Alternativnummer: MBL-CNA2002P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 59-176 of human TNFSF14/LIGHT (O43557).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 26kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEE
Target-Kategorie: TNFSF14
Application Verdünnung: WB: WB,1:100 - 1:500