SARS-CoV-2 Spike Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20137P
Artikelname: SARS-CoV-2 Spike Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20137P
Hersteller Artikelnummer: CNA20137P
Alternativnummer: MBL-CNA20137P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: DOT, ICC, IF, IP, WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (YP_009724390.1).
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2
Klonalität: Polyclonal
Molekulargewicht: 141kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: PGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLG
Target-Kategorie: Spike
Application Verdünnung: WB: DB,1:500 - 1:2000|WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000