SARS-CoV-2 Spike S2 ECD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20138T
Artikelname: SARS-CoV-2 Spike S2 ECD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20138T
Hersteller Artikelnummer: CNA20138T
Alternativnummer: MBL-CNA20138T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: DOT, ICC, IF, IP, WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of SARS-CoV-2 Spike S2 ECD (YP_009724390.1).
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2
Klonalität: Polyclonal
Molekulargewicht: 141kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
Target-Kategorie: Spike S2 ECD
Application Verdünnung: WB: DB,1:500 - 1:2000|WB,1:2000 - 1:6000|IF/ICC,1:50 - 1:200|IP,1:2000 - 1:6000