TMEM61 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20151T
Artikelname: TMEM61 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20151T
Hersteller Artikelnummer: CNA20151T
Alternativnummer: MBL-CNA20151T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 91-210 of human TMEM61 (NP_872338.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 22kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ASIPGPPRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARGGS
Target-Kategorie: TMEM61
Application Verdünnung: WB: WB,1:500 - 1:1000