SETD1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20155P
Artikelname: SETD1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20155P
Hersteller Artikelnummer: CNA20155P
Alternativnummer: MBL-CNA20155P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1673-1770 of human SETD1B (NP_001340274.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 213kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRAS
Target-Kategorie: SETD1B
Application Verdünnung: WB: WB,1:100 - 1:500