LPAR4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20157T
Artikelname: LPAR4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20157T
Hersteller Artikelnummer: CNA20157T
Alternativnummer: MBL-CNA20157T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 311-370 of human LPAR4 (Q99677).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Target-Kategorie: LPAR4
Application Verdünnung: WB: WB,1:500 - 1:1000