NRCAM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20160T
Artikelname: NRCAM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20160T
Hersteller Artikelnummer: CNA20160T
Alternativnummer: MBL-CNA20160T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-115 of human NRCAM (Q92823).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 144kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAE
Target-Kategorie: NRCAM
Application Verdünnung: WB: WB,1:500 - 1:1000