WRAP53 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20167T
Artikelname: WRAP53 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20167T
Hersteller Artikelnummer: CNA20167T
Alternativnummer: MBL-CNA20167T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human WRAP53 (NP_060551.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 59kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
Target-Kategorie: WRAP53
Application Verdünnung: WB: WB,1:500 - 1:1000