HJURP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20169T
Artikelname: HJURP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20169T
Hersteller Artikelnummer: CNA20169T
Alternativnummer: MBL-CNA20169T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human HJURP (NP_060880.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 84kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPA
Target-Kategorie: HJURP
Application Verdünnung: WB: WB,1:500 - 1:1000