Stella Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20176T
Artikelname: Stella Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20176T
Hersteller Artikelnummer: CNA20176T
Alternativnummer: MBL-CNA20176T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Stella (NP_631964.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN
Target-Kategorie: Dppa3
Application Verdünnung: WB: WB,1:500 - 1:1000