SLBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20178T
Artikelname: SLBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20178T
Hersteller Artikelnummer: CNA20178T
Alternativnummer: MBL-CNA20178T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 125-223 of human SLBP (NP_006518.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 31kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PADFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLESAESSSE
Target-Kategorie: SLBP
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200