MPC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20196T
Artikelname: MPC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20196T
Hersteller Artikelnummer: CNA20196T
Alternativnummer: MBL-CNA20196T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-60 of human MPC2 (NP_056230.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 14kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM
Target-Kategorie: MPC2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200