[KO Validated] Bax Rabbit mAb, Clone: [ARC5006-10], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20227P
Artikelname: [KO Validated] Bax Rabbit mAb, Clone: [ARC5006-10], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20227P
Hersteller Artikelnummer: CNA20227P
Alternativnummer: MBL-CNA20227P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC5006-10]
Molekulargewicht: 21kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
Target-Kategorie: BAX
Application Verdünnung: WB: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500