CD31/PECAM1 Rabbit mAb, Clone: [ARC5013-19], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20228T
Artikelname: CD31/PECAM1 Rabbit mAb, Clone: [ARC5013-19], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20228T
Hersteller Artikelnummer: CNA20228T
Alternativnummer: MBL-CNA20228T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC5013-19]
Molekulargewicht: 83KDa
Puffer: PBS with 0.01% thimerosal,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,0.05% BSA,50% glycerol
Sequenz: AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Target-Kategorie: PECAM1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000