SARS-CoV-2 ORF3A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20234T
Artikelname: SARS-CoV-2 ORF3A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20234T
Hersteller Artikelnummer: CNA20234T
Alternativnummer: MBL-CNA20234T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus ORF3A (YP_009724391.1).
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2
Klonalität: Polyclonal
Molekulargewicht: 31kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDC
Target-Kategorie: ORF3A
Application Verdünnung: WB: WB,1:2000 - 1:6000