ASB17 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20238T
Artikelname: ASB17 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20238T
Hersteller Artikelnummer: CNA20238T
Alternativnummer: MBL-CNA20238T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 78-177 of mouse ASB17 (NP_080034.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 34kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GHRFELNFNLEFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCSLALIWRTFTPVYCPSPLSGITPLLYVAQTRQSNILKILLQYGILEREKN
Target-Kategorie: Asb17
Application Verdünnung: WB: WB,1:500 - 1:1000