CKM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2024S
Artikelname: CKM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2024S
Hersteller Artikelnummer: CNA2024S
Alternativnummer: MBL-CNA2024S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-381 of human CKM (NP_001815.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 43kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFC
Target-Kategorie: CKM
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:20 - 1:200