Non-phospho-YAP1-S127 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20250T
Artikelname: Non-phospho-YAP1-S127 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20250T
Hersteller Artikelnummer: CNA20250T
Alternativnummer: MBL-CNA20250T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human YAP1 (NP_001123617.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSG
Target-Kategorie: YAP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200