GALNT7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20259T
Artikelname: GALNT7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20259T
Hersteller Artikelnummer: CNA20259T
Alternativnummer: MBL-CNA20259T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human GALNT7 (NP_059119.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 75kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPG
Target-Kategorie: GALNT7
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200