4-1BB/CD137 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2025P
Artikelname: 4-1BB/CD137 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2025P
Hersteller Artikelnummer: CNA2025P
Alternativnummer: MBL-CNA2025P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-186 of human 4-1BB/CD137 (NP_001552.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Target-Kategorie: TNFRSF9
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200