SARS-CoV-2 ORF9b Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20260T
Artikelname: |
SARS-CoV-2 ORF9b Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA20260T |
Hersteller Artikelnummer: |
CNA20260T |
Alternativnummer: |
MBL-CNA20260T |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Virus |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of coronavirus ORF9b (P0DTD2). |
Konjugation: |
Unconjugated |
Alternative Synonym: |
sars-cov-2 |
Klonalität: |
Polyclonal |
Molekulargewicht: |
11kDa |
Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
Sequenz: |
MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK |
Target-Kategorie: |
ORF9b |
Application Verdünnung: |
WB: WB,1:500 - 1:1000 |