RPS6KA1/RPS6KA2/RPS6KA3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20285T
Artikelname: RPS6KA1/RPS6KA2/RPS6KA3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20285T
Hersteller Artikelnummer: CNA20285T
Alternativnummer: MBL-CNA20285T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human RPS6KA1/RPS6KA2/RPS6KA3 (NP_002944.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAA
Target-Kategorie: RPS6KA1/RPS6KA2/RPS6KA3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200