TMEM119 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20287T
Artikelname: TMEM119 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20287T
Hersteller Artikelnummer: CNA20287T
Alternativnummer: MBL-CNA20287T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-270 of human TMEM119 (NP_859075.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 29kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPP
Target-Kategorie: TMEM119
Application Verdünnung: WB: WB,1:500 - 1:1000