CD99 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2028S
Artikelname: CD99 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2028S
Hersteller Artikelnummer: CNA2028S
Alternativnummer: MBL-CNA2028S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-185 of human CD99 (NP_002405.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 19kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Target-Kategorie: CD99
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200