SARS-CoV-2 NSP9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20308T
| Artikelname: |
SARS-CoV-2 NSP9 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA20308T |
| Hersteller Artikelnummer: |
CNA20308T |
| Alternativnummer: |
MBL-CNA20308T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Virus |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of coronavirus NSP9 (YP_009742616.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
sars-cov-2 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
794kDa |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of coronavirus NSP9 (YP_009742616.1). |
| Application Verdünnung: |
WB: WB,1:2000 - 1:6000 |
