TriMethyl-Histone H3-K36 Rabbit mAb, Clone: [ARC50050], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA20379P
Artikelname: TriMethyl-Histone H3-K36 Rabbit mAb, Clone: [ARC50050], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA20379P
Hersteller Artikelnummer: CNA20379P
Alternativnummer: MBL-CNA20379P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, DOT, IHC-P, IP, WB
Spezies Reaktivität: All, Human, Mouse, Rat
Immunogen: A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50050]
Molekulargewicht: 15kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target-Kategorie: A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Application Verdünnung: WB: DB,1:500 - 1:1000|WB,1:500 - 1:1000|IP,1:500 - 1:1000|IHC-P,1:50 - 1:200|ChIP,1:50 - 1:200|ChIP-seq,1:50 - 1:100