HCoV-229E Spike S2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20394P
| Artikelname: |
HCoV-229E Spike S2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA20394P |
| Hersteller Artikelnummer: |
CNA20394P |
| Alternativnummer: |
MBL-CNA20394P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of coronavirus Spike S2 (NP_073551.1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
129kDa |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
PRIPTMADFVQIENCNVTFVNISRSELQTIVPEYIDVNKTLQELSYKLPNYTVPDLVVEQYNQTILNLTSEISTLENKSAELNYTVQKLQTLIDNINSTLV |
| Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of coronavirus Spike S2 (NP_073551.1). |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
