Rev-Erbalpha/NR1D1 Rabbit mAb, Clone: [ARC50483], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA20452P
Artikelname: |
Rev-Erbalpha/NR1D1 Rabbit mAb, Clone: [ARC50483], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA20452P |
Hersteller Artikelnummer: |
CNA20452P |
Alternativnummer: |
MBL-CNA20452P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-Erbalpha/NR1D1 (NP_068370.1). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC50483] |
Molekulargewicht: |
67kDa |
Puffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
Sequenz: |
SPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-Erbalpha/NR1D1 (NP_068370.1). |
Application Verdünnung: |
WB: WB,1:500 - 1:1000 |