S100A8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20474P
Artikelname: S100A8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20474P
Hersteller Artikelnummer: CNA20474P
Alternativnummer: MBL-CNA20474P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of mouse S100A8 (NP_038678.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 10kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of mouse S100A8 (NP_038678.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200