KLK3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2052S
Artikelname: KLK3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2052S
Hersteller Artikelnummer: CNA2052S
Alternativnummer: MBL-CNA2052S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-261 of human KLK3 (NP_001639.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 29kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 30-261 of human KLK3 (NP_001639.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:1000 - 1:5000