CD68 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20555P
Artikelname: CD68 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20555P
Hersteller Artikelnummer: CNA20555P
Alternativnummer: MBL-CNA20555P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse CD68 (NP_001277987.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SHRPTTTSHGNVTVHTSSGPTTVTHNPATTTSHGNATISHATVSPTTNGTATSPRSSTVGPHPGPPPPSPSPRSKGALGNYTWANGSQPCVQLQAQIQIRI
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse CD68 (NP_001277987.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200