SARM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20556P
Artikelname: SARM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20556P
Hersteller Artikelnummer: CNA20556P
Alternativnummer: MBL-CNA20556P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 79kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: ALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 625-724 of human SARM1 (NP_055892.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000