SELENOK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20560P
Artikelname: SELENOK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20560P
Hersteller Artikelnummer: CNA20560P
Alternativnummer: MBL-CNA20560P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-94 of human SELENOK (NP_067060.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 11kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-94 of human SELENOK (NP_067060.2).
Application Verdünnung: WB: WB,1:500 - 1:1000