TOM1L2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20563P
Artikelname: |
TOM1L2 Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA20563P |
Hersteller Artikelnummer: |
CNA20563P |
Alternativnummer: |
MBL-CNA20563P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 310-450 of human TOM1L2 (NP_001076437.1). |
Konjugation: |
Unconjugated |
Klonalität: |
Polyclonal |
Molekulargewicht: |
56kDa |
Puffer: |
PBS with 0.05% proclin300,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
Sequenz: |
SGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDD |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 310-450 of human TOM1L2 (NP_001076437.1). |
Application Verdünnung: |
WB: WB,1:500 - 1:1000 |