SARS-CoV Spike Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20605P
Artikelname: SARS-CoV Spike Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20605P
Hersteller Artikelnummer: CNA20605P
Alternativnummer: MBL-CNA20605P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (NP_828851.1).
Konjugation: Unconjugated
Alternative Synonym: sars-cov
Klonalität: Polyclonal
Molekulargewicht: 139kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: DVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNF
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (NP_828851.1).
Application Verdünnung: WB: WB,1:500 - 1:1000