CDKN3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2061P
Artikelname: CDKN3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2061P
Hersteller Artikelnummer: CNA2061P
Alternativnummer: MBL-CNA2061P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human CDKN3 (NP_005183.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 24kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human CDKN3 (NP_005183.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200