IKKalpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2062P
Artikelname: IKKalpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2062P
Hersteller Artikelnummer: CNA2062P
Alternativnummer: MBL-CNA2062P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human IKKalpha (NP_001269.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 85kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human IKKalpha (NP_001269.3).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200