HER2/ErbB2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA2071S
Artikelname: HER2/ErbB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA2071S
Hersteller Artikelnummer: CNA2071S
Alternativnummer: MBL-CNA2071S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1160 to the C-terminus of human HER2/ErbB2 (NP_004439.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 138kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1160 to the C-terminus of human HER2/ErbB2 (NP_004439.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200